Recombinant Human Apolipoprotein B-100 (APOB), partial

In Stock
Code CSB-YP001918HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
APOB
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Apo B 100; Apo B; Apo B-100; Apo B-48; Apo B100; Apo B48; ApoB 100 ; ApoB 48; APOB; APOB_HUMAN; Apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; Apolipoprotein B; Apolipoprotein B-48; Apolipoprotein B100; Apolipoprotein B48; FLDB; LDLCQ4
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
28-127aa
Target Protein Sequence
EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
13.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Gene References into Functions
  1. Authors performed an analysis of public databases and literature for every variant published associated with FH, in the genes LDLR, APOB, and PCSK9. PMID: 29261184
  2. Targeted next generation DNA sequencing revealed several rare heterozygous missense variants in both MTTP and APOB genes known or predicted to be deleterious, in addition to a novel heterozygous missense variant in SAR1B, which encodes the gene causing chylomicron retention disease PMID: 29540175
  3. Single nucleotide polymorphisms rs693 and rs6725189 of the apoB gene are associated with calcific aortic stenosis in Chinese subjects, in Xinjiang, China. PMID: 29514644
  4. In conclusion, this study demonstrated that an APOB SNP, rs1042034, is closely associated with HCV infection through lipid metabolism alteration. PMID: 29382324
  5. APOB rs11279109 is associated with increased risk of coronary heart disease in Kuwaiti population. PMID: 29362515
  6. The simultaneous retention of fibrinogen and APOB-lipoproteins in FSD can be detected in routinely stained histological sections. The analysis of protein structures unraveled the pathomorphogenesis of this unexpected phenomenon. Fibrinogen gamma chain mutations provoke conformational changes in the region of the globular domain involved in the "end-to-end" interaction, thus impairing the D-dimer formation PMID: 29244742
  7. APOB polymorphism rs679899 is associated with type 2 diabetes and glutamyl transpeptidase levels, while the LIPC polymorphism rs6083 may influence plasma lipid levels in Chinese Han population. PMID: 29883758
  8. We present a case of homozygous familial defective apolipoprotein B-100 due to APOB R3500Q (rs5742904) treated with evolocumab ..Identification of a patient homozygous for familial defective apolipoprotein B-100(FDB) and successful treatment with PCSK9 inhibition PMID: 28988723
  9. Increased LDL levels were observed over time in patients with the -7673G>A polymorphism of the ApoB gene. PMID: 29846435
  10. Review/Meta-analysis: significant association of APOB rs1801701 GA, and APOB rs1042031 GA with increased risk of ischemic stroke. PMID: 28865324
  11. Serum apoB/A-I ratio appears to have value for predicting SAP in patients with AP. PMID: 28677336
  12. Apolipoprotein B is associated with carotid atherosclerosis progression PMID: 28826575
  13. Results show differences in the apoB100 secondary structure content among lipoproteins incubated at pH 7.4 or at pH 5.0 that could resemble those occurring in the early or late endosomes, respectively. PMID: 27824107
  14. Elevated serum apoB levels independently predict an increased risk for incident non-alcoholic fatty liver disease. PMID: 28106941
  15. This study shows that the ApoB-516C/T promoter gene polymorphism has no impact on the risk of hepatitis C virus infection. However, the C/T genotype may be a protective factor for females. PMID: 28370191
  16. association of TM6SF2 rs58542926 genotype with increased serum tyrosine levels and decreased apoB-100 particles in Finns PMID: 28539357
  17. that apos involved in TG metabolism such as apoC2, C3, E, and A4 (micromolar concentration), and apoB48 and apoA5 (single-digit nanomolar concentration) can be quantified from a single digestion mixture. PMID: 24694356
  18. These findings indicate that maternal apo B levels are significantly associated with apo B levels in their pre-school age children, adjusted for confounding variables. Furthermore, the mother-child correlations in apo B levels were independent of mother-child adiposity. Measurement of apo B levels in mothers may identify both high-risk children and mothers who may benefit from intervention. PMID: 28799493
  19. Individuals with apoB higher than predicted by non-HDL-C had significantly higher levels of PAI-1, which may contribute to the increased risk of future atherothrombotic events PMID: 28502501
  20. analysis of five likely pathogenic heterozygous rare variants that include four novel nonsense mutations in APOB (p.Gln845*, p.Gln2571*, p.Cys2933* and p.Ser3718*) and a rare variant in PCSK9 (Minor Allele Frequency <0.1%). PMID: 27179706
  21. In this sample of older adults with mild cognitive impairment, the presence of at least one copy of ApoE4 was associated with the development of both increased gait variability and cognitive decline during 1 year of follow-up PMID: 28482102
  22. The impact of smoking on the levels of apolipoprotein B (APOB) was evaluated by analyzing data from NHANES for the years 2007-2012 for US adolescents aged 12-19 years and adults aged greater than or eqult to 20 years. The study found that smoking did not influence the observed levels of APOB for either adolescents or adults. PMID: 28672200
  23. Identify LDLR, APOB and PCSK9 novel mutations causing familial hypercholesterolemia in the central south region of China. PMID: 28235710
  24. Rare variants of APOB or PCSK9 were identified in nine of the 22 study patients with extremely low LDL-C levels PMID: 29036232
  25. Eicosapentaenoic acid has direct antioxidant benefits in various apoB-containing subfractions. PMID: 26945158
  26. Association of plasma apoB with IR in obese subjects is dependent on gynoid WAT dysfunction PMID: 28391908
  27. Serum ApoB was not significantly different between term SGA newborns and control term newborns. PMID: 28304324
  28. APOB associated with Familial Hypercholesterolemia and Polygenic Hypercholesterolemia in patients with Acute Coronary Syndrome , age /=160 mg/dl. PMID: 28958330
  29. we identified common intronic SNPs (rs676210 and rs1042034) in the APOB gene and found five SNPs that were collectively associated with hyperlipidemia in the adult Chinese Yugur population. Importantly, we demonstrated that the G allele of rs676210 may confer an increased risk of hyperlipidemia. PMID: 28902930
  30. APOB missense variants, A224T and V925L, in a black South African woman with marked hypocholesterolemia PMID: 27206948
  31. male gender, ageing in women and menopause were associated with increased apoB concentrations. PMID: 27086565
  32. Data provide no evidence supporting an association between the APOB R3527Q variant and type 2 diabetes or glycemia. PMID: 28428224
  33. Levels of lipoprotein (a) [Lp(a)], a complex between an LDL-like lipid moiety containing one copy of apoB, and apo(a), a plasminogen-derived carbohydrate-rich hydrophilic protein, are primarily genetically rIncreasing evidence suggests that age, sex, and hormonal impact may have a modest modulatory influence on Lp(a) levels. Among clinical conditions, Lp(a) levels are reported to be affected by kidney and liver diseases. PMID: 26637279
  34. Data suggest that amphipathic beta-strands in 200 N-terminal residues of beta1 domain of APOB are required for secretion of lipid-rich or lipid-poor particles; residues 300-700 or 1050-1500 of beta1 domain appear to be required for secretion of lipid-rich particles; MTTP is required for secretion of intact APOB but not of truncated APOB. (APOB = apolipoprotein B; MTTP = microsomal triglyceride transfer protein) PMID: 28702990
  35. Basal apoB secretion by BeWo cells supports the concept of basal lipoprotein particle secretion by placental syncytiotrophoblast. PMID: 28487135
  36. ApoB EcoRI confers a moderate risk for coronary heart disease and the E(-) allele at this locus might be a susceptibility allele for the development of disease (Meta-Analysis) PMID: 27637205
  37. APOB single nucleotide polymorphism and it's association with LDL cholesterol level and risk of coronary heart disease in Pakistani population PMID: 27112212
  38. High apoB48 concentration is associated with Atherosclerotic Lesion Progression. PMID: 27487947
  39. Autoantibodies to oxidized lipoproteins and immune complexes with apoB-100 lipoproteins vary significantly by sex, age, and ethnicity. Higher baseline IgG MDA-LDL titers independently associate with new major adverse cardiovascular events. PMID: 28473443
  40. miR-548p regulates apoB secretion by targeting its mRNA degradation. PMID: 28336556
  41. Adolescent girls with obesity and polycystic ovary syndrome have elevated fasting and postprandial plasma triglycerides and ApoB-lipoprotein remnants. PMID: 27997268
  42. the associations of rs693 and rs562338 polymorphisms representing the Apolipoprotein B locus with endophenotypes (total cholesterol [TC] and high-density lipoprotein cholesterol) and phenotypes, were examined. PMID: 27683205
  43. ApoB100 is indispensable for HCV infection. ApoB is required for the generation of fully infectious HCV virions. PMID: 28018102
  44. a higher inflammatory status is associated with decreased triglyceride-rich-rich lipoprotein apoB-48 secretion among insulin resistant subjects PMID: 28183448
  45. Several protein markers were also deregulated in extracellular vesicless from bladder tumour patients, and our data suggest that the presence of ApoB in the 100,000 pellet is a clear marker for malignancy. PMID: 27751843
  46. 10 association studies for Han Chinese, with 1195 CHD patients and 1178 healthy subjects, we found that XbaI (rs693) polymorphisms in APOB were statistically significantly associated with Coronary Heart Disease in Han Chinese population PMID: 27172140
  47. We observed a significant interaction between Ins/Del ApoB genotype and dietary omega-3 PUFA intake with respect to BMI, WC, and obesity risk in both unadjusted (P = 0.007, P = 0.001, and P = 0.021, respectively) and adjusted (P = 0.007, P = 0.04, and P = 0.002, respectively) samples in NIDDM patients. PMID: 27210509
  48. Multiple novel LDLR and ApoB mutations have been identified in a-United Kingdom-based cohort with familial hypercholesterolemia. PMID: 26748104
  49. Data suggest that LDL-C/apoB ratio (ratio of plasma level of total cholesterol to plasma level of apolipoprotein B) is an important biomarker in overall evaluation of atherogenicity in obese, overweight, and normal-weight men; this study of qualitative changes in lipid/lipoprotein profile for early diagnosis of dyslipidemias leading to atherosclerosis was conducted in Russia. PMID: 27347637
  50. Mutations in APOB is associated with hypobetalipoproteinemia. PMID: 26916057

Show More

Hide All

Involvement in disease
Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Subcellular Location
Cytoplasm. Secreted. Lipid droplet.
Database Links

HGNC: 603

OMIM: 107730

KEGG: hsa:338

STRING: 9606.ENSP00000233242

UniGene: Hs.120759

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*